PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA022657-PA
Common NameOsI_22452
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 447aa    MW: 48119.7 Da    PI: 4.9546
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA022657-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.45.9e-081859338
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                      +r C+ + + +++++C  ++ +lC+ C ++ H+       H+
  BGIOSGA022657-PA 18 ARACDGCLRRRARWYCAADDAFLCQGCDTSVHSAnplarrHE 59
                      678*****************************6567777776 PP

2CCT67.34.1e-23392435144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  BGIOSGA022657-PA 392 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 435
                       9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.6231663IPR000315B-box-type zinc finger
SMARTSM003363.9E-111663IPR000315B-box-type zinc finger
PfamPF006431.2E-61860IPR000315B-box-type zinc finger
CDDcd000215.65E-91963No hitNo description
PfamPF062037.6E-18392434IPR010402CCT domain
PROSITE profilePS5101716.083392434IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MSSKAKAAAA GAVGAKSARA CDGCLRRRAR WYCAADDAFL CQGCDTSVHS ANPLARRHER  60
LRLRPSSPPP LVPPSGSGRR DEAVPAAWFK RKARTPRSHA AKSAAAVGQL LSRRLVVVPE  120
EAAGSGGDSP EERKDEGEIV EEQEQLLYRV PIFDPALSEF CSPPPLEDAA AAVSCCNEDG  180
AVENPTKPSM TTTTATTPPL QFFPDGHANF GPTDAELREF AADMEALLGR GLDDGNDEDS  240
FCMETLGLIE PVDDDAGRVK VEADGDAGMT LAWCHELDTE TSSGEMLDID FDYGSPQAAT  300
TPDEKVGSSG PAAAADDDAQ FQQSSLALSL NYEAIIESWG TSPWTDGERP RVKLDDSWPR  360
DYSGVWMAAA GVFGHGGEEQ ALTPRLGMDG GREARVSRYR EKRRTRLFSK KIRYEVRKLN  420
AEKRPRMKGR FVKRAAAAAA VATACVA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1402418RRTRLFSKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.388480.0leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976055440.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2412490.0AK241249.1 Oryza sativa Japonica Group cDNA, clone: J065129J23, full insert sequence.
GenBankAK2878360.0AK287836.1 Oryza sativa Japonica Group cDNA, clone: J065191O19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641417.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLA2YBG70.0A2YBG7_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA022657-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32833058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.14e-65B-box type zinc finger protein with CCT domain